PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.5176s0001.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 331aa    MW: 37777.1 Da    PI: 9.9022
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.5176s0001.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-3255108255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtp+LH rFv+ave+LGG+e+AtPk ++++m++kgL+++hvkSHLQ+YR+
  Araha.5176s0001.2.p  55 PRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQMYRS 108
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.75951111IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2951109IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1453109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2255110IPR006447Myb domain, plants
PfamPF002491.1E-956107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MIPSMEGGGK TNREEEEEAE KEEEEGEESK VSSNSTVEES DKKTKVRPYV RSKVPRLRWT  60
PDLHLRFVRA VERLGGQERA TPKLVRQMMN IKGLSIAHVK SHLQMYRSKK IDDQGQDRNI  120
YKLSQLPMFR GYNHDHDSPF RYGSKFSNAS LWNSSSHGTD RSLIEQIRPG LIRSSSVSNN  180
IRGSEYWTNN RSFKNIYSSS ISNHLPKLRH DHQERTNSVT FNSMQGHSRT FQKFHIGVEE  240
STNHSYFSKT TGKRNASTSI DLDLDLSLKL RQPEKTILEE TETAATTTDQ TLSLSLCPGS  300
SSWKKNRLIK KDEEDRTVKI GQASTLDLTL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1176890.0AK117689.1 Arabidopsis thaliana At2g38300 mRNA for unknown protein, complete cds, clone: RAFL17-35-G17.
GenBankBT0049730.0BT004973.1 Arabidopsis thaliana clone U50495 unknown protein (At2g38300) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181364.20.0myb-like HTH transcriptional regulator-like protein
TrEMBLQ8GYE40.0Q8GYE4_ARATH; Myb-like HTH transcriptional regulator-like protein
STRINGAT2G38300.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.10.0G2-like family protein